PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g021633m
Common NameCISIN_1g021633mg, LOC102621113
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 311aa    MW: 34148.2 Da    PI: 7.055
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g021633mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.22.4e-4052112262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +++alkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+s
  orange1.1g021633m  52 HDQALKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVS 112
                        6899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-2946106IPR003851Zinc finger, Dof-type
PfamPF027019.8E-3453110IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.18956110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MMGLTSLQVC MDSSDWLQGS IHEESGLDSS SPSGDMLTCS RPLMERRLRP PHDQALKCPR  60
CDSTHTKFCY YNNYSLSQPR YFCKTCRRYW TKGGTLRNIP VGGGCRKNKK VSSKKSNDQS  120
MNQNPGSSSH NPTDLQLSFP EMQFSHLGNI LGAHGTLANN HNFMDNKYSA MLENPRPIDF  180
MENKLEAIVG SSRNYDFMGN NGDMGMVGGL GNLSHHHQEG LTPNVHNLCS PFGMSLDGTG  240
GTFIDGCQRI MLPYDANEVQ NAIDVKPNAK LLSLDWQDQS CSDVGYLGNL GSSWSGMMNG  300
YGSSTTNSLV *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006439825.10.0hypothetical protein CICLE_v10021278mg
RefseqXP_006476784.10.0PREDICTED: dof zinc finger protein DOF5.6
SwissprotQ9FM032e-66DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A067FQG50.0A0A067FQG5_CITSI; Uncharacterized protein
TrEMBLV4TN030.0V4TN03_9R
STRINGVIT_17s0000g08290.t011e-172(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.13e-65Dof family protein